PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)

PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008495-D01P
PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPFIBP2 protein.
Información adicional
Size 100 ug
Gene Name PPFIBP2
Gene Alias Cclp1|DKFZp781K06126|MGC42541
Gene Description PTPRF interacting protein, binding protein 2 (liprin beta 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHSAASNETYQERLARLEGDKESLILQVSVITDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQKLDLMTEVSELKLKLVGMEKEQREQEEKQRKAEELLQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPFIBP2 (NP_003612.1, 1 a.a. ~ 876 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8495

Enviar un mensaje


PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)

PPFIBP2 purified MaxPab rabbit polyclonal antibody (D01P)