PPFIBP2 polyclonal antibody (A01)
  • PPFIBP2 polyclonal antibody (A01)

PPFIBP2 polyclonal antibody (A01)

Ref: AB-H00008495-A01
PPFIBP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPFIBP2.
Información adicional
Size 50 uL
Gene Name PPFIBP2
Gene Alias Cclp1|DKFZp781K06126|MGC42541
Gene Description PTPRF interacting protein, binding protein 2 (liprin beta 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASDASHALEAALEQMDGIIAGTKTGADLSDGTCEPGLASPASYMNPFPVLHLIEDLRLALEMLELPQERAALLSQIPGPTAAYIKEWFEESLSQVNHHS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPFIBP2 (NP_003612, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8495

Enviar un mensaje


PPFIBP2 polyclonal antibody (A01)

PPFIBP2 polyclonal antibody (A01)