PRSS12 MaxPab mouse polyclonal antibody (B01P)
  • PRSS12 MaxPab mouse polyclonal antibody (B01P)

PRSS12 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008492-B01P
PRSS12 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRSS12 protein.
Información adicional
Size 50 ug
Gene Name PRSS12
Gene Alias BSSP-3|BSSP3|MGC12722|MRT1
Gene Description protease, serine, 12 (neurotrypsin, motopsin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTLARFVLALMLGALPEVVGFDSVLNDSLHHSHRHSPPAGPHYPYYLPTQQRPPTTRPPPPLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFEGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRSS12 (AAH07761.1, 1 a.a. ~ 505 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8492

Enviar un mensaje


PRSS12 MaxPab mouse polyclonal antibody (B01P)

PRSS12 MaxPab mouse polyclonal antibody (B01P)