RGS5 polyclonal antibody (A01)
  • RGS5 polyclonal antibody (A01)

RGS5 polyclonal antibody (A01)

Ref: AB-H00008490-A01
RGS5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RGS5.
Información adicional
Size 50 uL
Gene Name RGS5
Gene Alias MST092|MST106|MST129|MSTP032|MSTP092|MSTP106|MSTP129
Gene Description regulator of G-protein signaling 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS5 (NM_003617, 94 a.a. ~ 181 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8490

Enviar un mensaje


RGS5 polyclonal antibody (A01)

RGS5 polyclonal antibody (A01)