Ver mas grande
SEMA7A monoclonal antibody (M06), clone 1G1
AB-H00008482-M06
Producto nuevo
SEMA7A monoclonal antibody (M06), clone 1G1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SEMA7A |
| Gene Alias | CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL |
| Gene Description | semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SEMA7A (NP_003603, 536 a.a. ~ 633 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 8482 |
| Clone Number | 1G1 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SEMA7A.