SEMA7A monoclonal antibody (M06), clone 1G1
  • SEMA7A monoclonal antibody (M06), clone 1G1

SEMA7A monoclonal antibody (M06), clone 1G1

Ref: AB-H00008482-M06
SEMA7A monoclonal antibody (M06), clone 1G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEMA7A.
Información adicional
Size 100 ug
Gene Name SEMA7A
Gene Alias CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL
Gene Description semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA7A (NP_003603, 536 a.a. ~ 633 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8482
Clone Number 1G1
Iso type IgG2a Kappa

Enviar un mensaje


SEMA7A monoclonal antibody (M06), clone 1G1

SEMA7A monoclonal antibody (M06), clone 1G1