SEMA7A polyclonal antibody (A01)
  • SEMA7A polyclonal antibody (A01)

SEMA7A polyclonal antibody (A01)

Ref: AB-H00008482-A01
SEMA7A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA7A.
Información adicional
Size 50 uL
Gene Name SEMA7A
Gene Alias CD108|CDw108|H-SEMA-K1|H-Sema-L|JMH|MGC126692|MGC126696|SEMAK1|SEMAL
Gene Description semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA7A (NP_003603, 536 a.a. ~ 633 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8482

Enviar un mensaje


SEMA7A polyclonal antibody (A01)

SEMA7A polyclonal antibody (A01)