CDC42BPA monoclonal antibody (M01), clone 1G7
  • CDC42BPA monoclonal antibody (M01), clone 1G7

CDC42BPA monoclonal antibody (M01), clone 1G7

Ref: AB-H00008476-M01
CDC42BPA monoclonal antibody (M01), clone 1G7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDC42BPA.
Información adicional
Size 100 ug
Gene Name CDC42BPA
Gene Alias DKFZp686L1738|DKFZp686P1738|FLJ23347|KIAA0451|MRCK|MRCKA|PK428
Gene Description CDC42 binding protein kinase alpha (DMPK-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LVQASERLKNQSKELKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRTERAKKELEVHTEALAAEASKDRKLRE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42BPA (NP_003598, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8476
Clone Number 1G7
Iso type IgG1 Kappa

Enviar un mensaje


CDC42BPA monoclonal antibody (M01), clone 1G7

CDC42BPA monoclonal antibody (M01), clone 1G7