FKBP6 monoclonal antibody (M01), clone 8F10
  • FKBP6 monoclonal antibody (M01), clone 8F10

FKBP6 monoclonal antibody (M01), clone 8F10

Ref: AB-H00008468-M01
FKBP6 monoclonal antibody (M01), clone 8F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FKBP6.
Información adicional
Size 100 ug
Gene Name FKBP6
Gene Alias FKBP36|MGC87179|PPIase
Gene Description FK506 binding protein 6, 36kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FKBP6 (NP_003593.2, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8468
Clone Number 8F10
Iso type IgG2a Kappa

Enviar un mensaje


FKBP6 monoclonal antibody (M01), clone 8F10

FKBP6 monoclonal antibody (M01), clone 8F10