KLF11 monoclonal antibody (M02), clone 10C5
  • KLF11 monoclonal antibody (M02), clone 10C5

KLF11 monoclonal antibody (M02), clone 10C5

Ref: AB-H00008462-M02
KLF11 monoclonal antibody (M02), clone 10C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF11.
Información adicional
Size 100 ug
Gene Name KLF11
Gene Alias FKLF|FKLF1|MODY7|TIEG2|Tieg3
Gene Description Kruppel-like factor 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF11 (NP_003588, 404 a.a. ~ 512 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8462
Clone Number 10C5
Iso type IgG2a Kappa

Enviar un mensaje


KLF11 monoclonal antibody (M02), clone 10C5

KLF11 monoclonal antibody (M02), clone 10C5