TTF2 monoclonal antibody (M10A), clone 1E4
  • TTF2 monoclonal antibody (M10A), clone 1E4

TTF2 monoclonal antibody (M10A), clone 1E4

Ref: AB-H00008458-M10A
TTF2 monoclonal antibody (M10A), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTF2.
Información adicional
Size 200 uL
Gene Name TTF2
Gene Alias HuF2
Gene Description transcription termination factor, RNA polymerase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTF2 (NP_003585, 385 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8458
Clone Number 1E4
Iso type IgG2a Kappa

Enviar un mensaje


TTF2 monoclonal antibody (M10A), clone 1E4

TTF2 monoclonal antibody (M10A), clone 1E4