TTF2 monoclonal antibody (M02), clone 3D11
  • TTF2 monoclonal antibody (M02), clone 3D11

TTF2 monoclonal antibody (M02), clone 3D11

Ref: AB-H00008458-M02
TTF2 monoclonal antibody (M02), clone 3D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TTF2.
Información adicional
Size 100 ug
Gene Name TTF2
Gene Alias HuF2
Gene Description transcription termination factor, RNA polymerase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TTF2 (NP_003585, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8458
Clone Number 3D11
Iso type IgG2a Kappa

Enviar un mensaje


TTF2 monoclonal antibody (M02), clone 3D11

TTF2 monoclonal antibody (M02), clone 3D11