NCK2 polyclonal antibody (A01)
  • NCK2 polyclonal antibody (A01)

NCK2 polyclonal antibody (A01)

Ref: AB-H00008440-A01
NCK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCK2.
Información adicional
Size 50 uL
Gene Name NCK2
Gene Alias GRB4|NCKbeta
Gene Description NCK adaptor protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCK2 (NP_003572, 203 a.a. ~ 312 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8440

Enviar un mensaje


NCK2 polyclonal antibody (A01)

NCK2 polyclonal antibody (A01)