RAD54L monoclonal antibody (M01), clone 4G2
  • RAD54L monoclonal antibody (M01), clone 4G2

RAD54L monoclonal antibody (M01), clone 4G2

Ref: AB-H00008438-M01
RAD54L monoclonal antibody (M01), clone 4G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAD54L.
Información adicional
Size 100 ug
Gene Name RAD54L
Gene Alias HR54|RAD54A|hHR54|hRAD54
Gene Description RAD54-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD54L (NP_003570, 638 a.a. ~ 747 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8438
Clone Number 4G2
Iso type IgG3 Kappa

Enviar un mensaje


RAD54L monoclonal antibody (M01), clone 4G2

RAD54L monoclonal antibody (M01), clone 4G2