SDPR purified MaxPab rabbit polyclonal antibody (D01P)
  • SDPR purified MaxPab rabbit polyclonal antibody (D01P)

SDPR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008436-D01P
SDPR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SDPR protein.
Información adicional
Size 100 ug
Gene Name SDPR
Gene Alias PS-p68|SDR
Gene Description serum deprivation response (phosphatidylserine binding protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SDPR (NP_004648.1, 1 a.a. ~ 425 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8436

Enviar un mensaje


SDPR purified MaxPab rabbit polyclonal antibody (D01P)

SDPR purified MaxPab rabbit polyclonal antibody (D01P)