RECK purified MaxPab rabbit polyclonal antibody (D01P)
  • RECK purified MaxPab rabbit polyclonal antibody (D01P)

RECK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008434-D01P
RECK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RECK protein.
Información adicional
Size 100 ug
Gene Name RECK
Gene Alias ST15|hRECK
Gene Description reversion-inducing-cysteine-rich protein with kazal motifs
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRAPDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RECK (NP_066934.1, 1 a.a. ~ 971 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8434

Enviar un mensaje


RECK purified MaxPab rabbit polyclonal antibody (D01P)

RECK purified MaxPab rabbit polyclonal antibody (D01P)