RECK MaxPab rabbit polyclonal antibody (D01)
  • RECK MaxPab rabbit polyclonal antibody (D01)

RECK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008434-D01
RECK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RECK protein.
Información adicional
Size 100 uL
Gene Name RECK
Gene Alias ST15|hRECK
Gene Description reversion-inducing-cysteine-rich protein with kazal motifs
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRAPDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RECK (NP_066934.1, 1 a.a. ~ 971 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8434

Enviar un mensaje


RECK MaxPab rabbit polyclonal antibody (D01)

RECK MaxPab rabbit polyclonal antibody (D01)