BBOX1 monoclonal antibody (M01), clone 6H3
  • BBOX1 monoclonal antibody (M01), clone 6H3

BBOX1 monoclonal antibody (M01), clone 6H3

Ref: AB-H00008424-M01
BBOX1 monoclonal antibody (M01), clone 6H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BBOX1.
Información adicional
Size 100 ug
Gene Name BBOX1
Gene Alias BBH|BBOX|G-BBH|gamma-BBH
Gene Description butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq IELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BBOX1 (NP_003977, 278 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8424
Clone Number 6H3
Iso type IgG1 Kappa

Enviar un mensaje


BBOX1 monoclonal antibody (M01), clone 6H3

BBOX1 monoclonal antibody (M01), clone 6H3