SRPX purified MaxPab mouse polyclonal antibody (B01P)
  • SRPX purified MaxPab mouse polyclonal antibody (B01P)

SRPX purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008406-B01P
SRPX purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SRPX protein.
Información adicional
Size 50 ug
Gene Name SRPX
Gene Alias DRS|ETX1|SRPX1
Gene Description sushi-repeat-containing protein, X-linked
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRPX (NP_006298.1, 1 a.a. ~ 464 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8406

Enviar un mensaje


SRPX purified MaxPab mouse polyclonal antibody (B01P)

SRPX purified MaxPab mouse polyclonal antibody (B01P)