SPOP monoclonal antibody (M04), clone 3E2
  • SPOP monoclonal antibody (M04), clone 3E2

SPOP monoclonal antibody (M04), clone 3E2

Ref: AB-H00008405-M04
SPOP monoclonal antibody (M04), clone 3E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPOP.
Información adicional
Size 100 ug
Gene Name SPOP
Gene Alias TEF2
Gene Description speckle-type POZ protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPOP (NP_001007227.1, 301 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8405
Clone Number 3E2
Iso type IgG2a Kappa

Enviar un mensaje


SPOP monoclonal antibody (M04), clone 3E2

SPOP monoclonal antibody (M04), clone 3E2