SLC25A11 polyclonal antibody (A01)
  • SLC25A11 polyclonal antibody (A01)

SLC25A11 polyclonal antibody (A01)

Ref: AB-H00008402-A01
SLC25A11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SLC25A11.
Información adicional
Size 50 uL
Gene Name SLC25A11
Gene Alias OGC|SLC20A4
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC25A11 (AAH16294, 1 a.a. ~ 314 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8402

Enviar un mensaje


SLC25A11 polyclonal antibody (A01)

SLC25A11 polyclonal antibody (A01)