PLA2G10 monoclonal antibody (M01), clone 5G11
  • PLA2G10 monoclonal antibody (M01), clone 5G11

PLA2G10 monoclonal antibody (M01), clone 5G11

Ref: AB-H00008399-M01
PLA2G10 monoclonal antibody (M01), clone 5G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLA2G10.
Información adicional
Size 100 ug
Gene Name PLA2G10
Gene Alias GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2
Gene Description phospholipase A2, group X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLA2G10 (NP_003552.1, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8399
Clone Number 5G11
Iso type IgG1 Kappa

Enviar un mensaje


PLA2G10 monoclonal antibody (M01), clone 5G11

PLA2G10 monoclonal antibody (M01), clone 5G11