PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)
  • PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)

PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008399-D01P
PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLA2G10 protein.
Información adicional
Size 100 ug
Gene Name PLA2G10
Gene Alias GXPLA2|GXSPLA2|MGC119918|MGC119919|MGC133367|SPLA2
Gene Description phospholipase A2, group X
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLA2G10 (NP_003552.1, 1 a.a. ~ 165 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8399

Enviar un mensaje


PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)

PLA2G10 purified MaxPab rabbit polyclonal antibody (D01P)