HYAL3 monoclonal antibody (M01), clone 3A3
  • HYAL3 monoclonal antibody (M01), clone 3A3

HYAL3 monoclonal antibody (M01), clone 3A3

Ref: AB-H00008372-M01
HYAL3 monoclonal antibody (M01), clone 3A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HYAL3.
Información adicional
Size 100 ug
Gene Name HYAL3
Gene Alias LUCA-3|LUCA14|LUCA3|Minna14
Gene Description hyaluronoglucosaminidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL3 (AAH05896, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8372
Clone Number 3A3
Iso type IgG2a Kappa

Enviar un mensaje


HYAL3 monoclonal antibody (M01), clone 3A3

HYAL3 monoclonal antibody (M01), clone 3A3