HYAL3 polyclonal antibody (A01)
  • HYAL3 polyclonal antibody (A01)

HYAL3 polyclonal antibody (A01)

Ref: AB-H00008372-A01
HYAL3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HYAL3.
Información adicional
Size 50 uL
Gene Name HYAL3
Gene Alias LUCA-3|LUCA14|LUCA3|Minna14
Gene Description hyaluronoglucosaminidase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL3 (AAH05896, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8372

Enviar un mensaje


HYAL3 polyclonal antibody (A01)

HYAL3 polyclonal antibody (A01)