HIST1H3G polyclonal antibody (A01)
  • HIST1H3G polyclonal antibody (A01)

HIST1H3G polyclonal antibody (A01)

Ref: AB-H00008355-A01
HIST1H3G polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HIST1H3G.
Información adicional
Size 50 uL
Gene Name HIST1H3G
Gene Alias H3/h|H3FH
Gene Description histone cluster 1, H3g
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H3G (NP_003525, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8355

Enviar un mensaje


HIST1H3G polyclonal antibody (A01)

HIST1H3G polyclonal antibody (A01)