HIST1H2BC polyclonal antibody (A01)
  • HIST1H2BC polyclonal antibody (A01)

HIST1H2BC polyclonal antibody (A01)

Ref: AB-H00008347-A01
HIST1H2BC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HIST1H2BC.
Información adicional
Size 50 uL
Gene Name HIST1H2BC
Gene Alias H2B.1|H2B/l|H2BFL|MGC104246|dJ221C16.3
Gene Description histone cluster 1, H2bc
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H2BC (AAH09612, 1 a.a. ~ 126 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8347

Enviar un mensaje


HIST1H2BC polyclonal antibody (A01)

HIST1H2BC polyclonal antibody (A01)