HIST1H2BN polyclonal antibody (A01)
  • HIST1H2BN polyclonal antibody (A01)

HIST1H2BN polyclonal antibody (A01)

Ref: AB-H00008341-A01
HIST1H2BN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HIST1H2BN.
Información adicional
Size 50 uL
Gene Name HIST1H2BN
Gene Alias H2B/d|H2BFD|HIST1H3I|MGC125414|MGC125415|MGC125416|MGC9388
Gene Description histone cluster 1, H2bn
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSKKRKRRFTESIKKAHGFRKLKIWLKLRVSNQSPDDIYIARD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H2BN (AAH11372, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8341

Enviar un mensaje


HIST1H2BN polyclonal antibody (A01)

HIST1H2BN polyclonal antibody (A01)