HIST2H2AA monoclonal antibody (M01), clone 4C10
  • HIST2H2AA monoclonal antibody (M01), clone 4C10

HIST2H2AA monoclonal antibody (M01), clone 4C10

Ref: AB-H00008337-M01
HIST2H2AA monoclonal antibody (M01), clone 4C10

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HIST2H2AA.
Información adicional
Size 100 ug
Gene Name HIST2H2AA3
Gene Alias H2A|H2A.2|H2A/O|H2A/q|H2AFO|H2a-615|HIST2H2AA
Gene Description histone cluster 2, H2aa3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST2H2AA (AAH01629, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8337
Clone Number 4C10
Iso type IgG2a Kappa

Enviar un mensaje


HIST2H2AA monoclonal antibody (M01), clone 4C10

HIST2H2AA monoclonal antibody (M01), clone 4C10