HIST1H2AC monoclonal antibody (M01), clone 4F10
  • HIST1H2AC monoclonal antibody (M01), clone 4F10

HIST1H2AC monoclonal antibody (M01), clone 4F10

Ref: AB-H00008334-M01
HIST1H2AC monoclonal antibody (M01), clone 4F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIST1H2AC.
Información adicional
Size 100 ug
Gene Name HIST1H2AC
Gene Alias H2A/l|H2AFL|MGC99519|dJ221C16.4
Gene Description histone cluster 1, H2ac
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H2AC (NP_003503, 25 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8334
Clone Number 4F10
Iso type IgG1 Kappa

Enviar un mensaje


HIST1H2AC monoclonal antibody (M01), clone 4F10

HIST1H2AC monoclonal antibody (M01), clone 4F10