FZD4 polyclonal antibody (A01)
  • FZD4 polyclonal antibody (A01)

FZD4 polyclonal antibody (A01)

Ref: AB-H00008322-A01
FZD4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FZD4.
Información adicional
Size 50 uL
Gene Name FZD4
Gene Alias CD344|EVR1|FEVR|FZD4S|Fz-4|FzE4|GPCR|MGC34390
Gene Description frizzled homolog 4 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FZD4 (NP_036325, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8322

Enviar un mensaje


FZD4 polyclonal antibody (A01)

FZD4 polyclonal antibody (A01)