CDC45L monoclonal antibody (M01), clone 3F11-1F3
  • CDC45L monoclonal antibody (M01), clone 3F11-1F3

CDC45L monoclonal antibody (M01), clone 3F11-1F3

Ref: AB-H00008318-M01
CDC45L monoclonal antibody (M01), clone 3F11-1F3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CDC45L.
Información adicional
Size 100 ug
Gene Name CDC45L
Gene Alias CDC45|CDC45L2|PORC-PI-1
Gene Description CDC45 cell division cycle 45-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC45L (AAH06232, 1 a.a. ~ 566 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8318
Clone Number 3F11-1F3
Iso type IgG2b Kappa

Enviar un mensaje


CDC45L monoclonal antibody (M01), clone 3F11-1F3

CDC45L monoclonal antibody (M01), clone 3F11-1F3