CDC45L purified MaxPab rabbit polyclonal antibody (D01P)
  • CDC45L purified MaxPab rabbit polyclonal antibody (D01P)

CDC45L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008318-D01P
CDC45L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDC45L protein.
Información adicional
Size 100 ug
Gene Name CDC45L
Gene Alias CDC45|CDC45L2|PORC-PI-1
Gene Description CDC45 cell division cycle 45-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRLEEEIVEQTMRRRQRREWEARRRDILFDYEQYEYHGTSSAMVMFELAWMLSKDLNDMLWWAIVGLTDQWVQDKITQMKYVTDVGVLQRHVSRHNHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDC45L (NP_003495.1, 1 a.a. ~ 566 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8318

Enviar un mensaje


CDC45L purified MaxPab rabbit polyclonal antibody (D01P)

CDC45L purified MaxPab rabbit polyclonal antibody (D01P)