ACOX2 monoclonal antibody (M02), clone 1A7
  • ACOX2 monoclonal antibody (M02), clone 1A7

ACOX2 monoclonal antibody (M02), clone 1A7

Ref: AB-H00008309-M02
ACOX2 monoclonal antibody (M02), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACOX2.
Información adicional
Size 100 ug
Gene Name ACOX2
Gene Alias BCOX|BRCACOX|BRCOX|THCCox
Gene Description acyl-Coenzyme A oxidase 2, branched chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACOX2 (NP_003491, 582 a.a. ~ 681 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8309
Clone Number 1A7
Iso type IgG1 Kappa

Enviar un mensaje


ACOX2 monoclonal antibody (M02), clone 1A7

ACOX2 monoclonal antibody (M02), clone 1A7