ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)

ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008309-D01P
ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACOX2 protein.
Información adicional
Size 100 ug
Gene Name ACOX2
Gene Alias BCOX|BRCACOX|BRCOX|THCCox
Gene Description acyl-Coenzyme A oxidase 2, branched chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQNERYKAAMRRAFHIRLIARRLGWLEDGRELGYAYRALSGDVALNIHRVFVRALRSLGSEEQIAKWDPLCKNIQIIATYAQTELGHGTYLQGLETEATYDAATQEFVIHSPTLTATKWWPGDLGRSATHALVQAQLICSGARRGMHAFIVPIRSLQDHTPLPGIIIGDIGPKMDFDQTDNGFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACOX2 (NP_003491.1, 1 a.a. ~ 681 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8309

Enviar un mensaje


ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)

ACOX2 purified MaxPab rabbit polyclonal antibody (D01P)