HIST1H4I polyclonal antibody (A01)
  • HIST1H4I polyclonal antibody (A01)

HIST1H4I polyclonal antibody (A01)

Ref: AB-H00008294-A01
HIST1H4I polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant HIST1H4I.
Información adicional
Size 50 uL
Gene Name HIST1H4I
Gene Alias H4/m|H4FM|H4M
Gene Description histone cluster 1, H4i
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGPIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIST1H4I (AAH16336, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8294

Enviar un mensaje


HIST1H4I polyclonal antibody (A01)

HIST1H4I polyclonal antibody (A01)