SERF1A polyclonal antibody (A01)
  • SERF1A polyclonal antibody (A01)

SERF1A polyclonal antibody (A01)

Ref: AB-H00008293-A01
SERF1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SERF1A.
Información adicional
Size 50 uL
Gene Name SERF1A
Gene Alias 4F5|FAM2A|H4F5|SERF1|SMAM1
Gene Description small EDRK-rich factor 1A (telomeric)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERF1A (NP_068802, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8293

Enviar un mensaje


SERF1A polyclonal antibody (A01)

SERF1A polyclonal antibody (A01)