COLQ polyclonal antibody (A01)
  • COLQ polyclonal antibody (A01)

COLQ polyclonal antibody (A01)

Ref: AB-H00008292-A01
COLQ polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COLQ.
Información adicional
Size 50 uL
Gene Name COLQ
Gene Alias EAD
Gene Description collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COLQ (NP_005668, 356 a.a. ~ 455 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8292

Enviar un mensaje


COLQ polyclonal antibody (A01)

COLQ polyclonal antibody (A01)