ARID1A polyclonal antibody (A01)
  • ARID1A polyclonal antibody (A01)

ARID1A polyclonal antibody (A01)

Ref: AB-H00008289-A01
ARID1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ARID1A.
Información adicional
Size 50 uL
Gene Name ARID1A
Gene Alias B120|BAF250|BAF250a|BM029|C1orf4|P270|SMARCF1
Gene Description AT rich interactive domain 1A (SWI-like)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARID1A (NP_006006, 1216 a.a. ~ 1325 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8289

Enviar un mensaje


ARID1A polyclonal antibody (A01)

ARID1A polyclonal antibody (A01)