UBL4A monoclonal antibody (M02A), clone 1C10
  • UBL4A monoclonal antibody (M02A), clone 1C10

UBL4A monoclonal antibody (M02A), clone 1C10

Ref: AB-H00008266-M02A
UBL4A monoclonal antibody (M02A), clone 1C10

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UBL4A.
Información adicional
Size 200 uL
Gene Name UBL4A
Gene Alias DX254E|DXS254E|G6PD|GDX|UBL4
Gene Description ubiquitin-like 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBL4A (AAH43346, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8266
Clone Number 1C10
Iso type IgM Kappa

Enviar un mensaje


UBL4A monoclonal antibody (M02A), clone 1C10

UBL4A monoclonal antibody (M02A), clone 1C10