ARD1A polyclonal antibody (A01)
  • ARD1A polyclonal antibody (A01)

ARD1A polyclonal antibody (A01)

Ref: AB-H00008260-A01
ARD1A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant ARD1A.
Información adicional
Size 50 uL
Gene Name ARD1A
Gene Alias ARD1|DXS707|MGC71248|TE2
Gene Description ARD1 homolog A, N-acetyltransferase (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ARD1A (AAH00308, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8260

Enviar un mensaje


ARD1A polyclonal antibody (A01)

ARD1A polyclonal antibody (A01)