U2AF1L2 monoclonal antibody (M03), clone 2H5
  • U2AF1L2 monoclonal antibody (M03), clone 2H5

U2AF1L2 monoclonal antibody (M03), clone 2H5

Ref: AB-H00008233-M03
U2AF1L2 monoclonal antibody (M03), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant U2AF1L2.
Información adicional
Size 100 ug
Gene Name ZRSR2
Gene Alias MGC142014|MGC142040|U2AF1-RS2|U2AF1L2|U2AF1RS2|URP
Gene Description zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen U2AF1L2 (NP_005080.1, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8233
Clone Number 2H5
Iso type IgG2a Kappa

Enviar un mensaje


U2AF1L2 monoclonal antibody (M03), clone 2H5

U2AF1L2 monoclonal antibody (M03), clone 2H5