SYN3 MaxPab rabbit polyclonal antibody (D01)
  • SYN3 MaxPab rabbit polyclonal antibody (D01)

SYN3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008224-D01
SYN3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SYN3 protein.
Información adicional
Size 100 uL
Gene Name SYN3
Gene Alias -
Gene Description synapsin III
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MNFLRRRLSDSSFMANLPNGYMTDLQRPDSSTSSPASPAMERRHPQPLAASFSSPGSSLFSSLSSAMKQAPQATSGLMEPPGPSTPIVQRPRILLVIDDAHTDWSKYFHGKKVNGEIEIRVEQAEFSELNLAAYVTGGCMVDMQVVRNGTKVVSRSFKPDFILVRQHAYSMALGEDYRSLVIGLQYGGLPAVNSLYSVYNFCSKPWVFSQLIKIFHSLGPEKFPLVEQTFFPNHKPMVTAPHFPVVVKLGHAHAG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SYN3 (AAH75065.1, 1 a.a. ~ 580 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8224

Enviar un mensaje


SYN3 MaxPab rabbit polyclonal antibody (D01)

SYN3 MaxPab rabbit polyclonal antibody (D01)