C21orf33 polyclonal antibody (A01)
  • C21orf33 polyclonal antibody (A01)

C21orf33 polyclonal antibody (A01)

Ref: AB-H00008209-A01
C21orf33 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C21orf33.
Información adicional
Size 50 uL
Gene Name C21orf33
Gene Alias D21S2048E|ES1|GT335|HES1|KNP-I|KNPH|KNPI
Gene Description chromosome 21 open reading frame 33
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8209

Enviar un mensaje


C21orf33 polyclonal antibody (A01)

C21orf33 polyclonal antibody (A01)