NRIP1 polyclonal antibody (A01)
  • NRIP1 polyclonal antibody (A01)

NRIP1 polyclonal antibody (A01)

Ref: AB-H00008204-A01
NRIP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRIP1.
Información adicional
Size 50 uL
Gene Name NRIP1
Gene Alias FLJ77253|RIP140
Gene Description nuclear receptor interacting protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KNEYEKDSPRLTKTNPILYYMLQKGGNSVTSRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSANGEVYGLLGSVLTIKKESE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRIP1 (NP_003480, 1051 a.a. ~ 1158 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8204

Enviar un mensaje


NRIP1 polyclonal antibody (A01)

NRIP1 polyclonal antibody (A01)