NCOA3 polyclonal antibody (A01)
  • NCOA3 polyclonal antibody (A01)

NCOA3 polyclonal antibody (A01)

Ref: AB-H00008202-A01
NCOA3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCOA3.
Información adicional
Size 50 uL
Gene Name NCOA3
Gene Alias ACTR|AIB-1|AIB1|CAGH16|CTG26|KAT13B|MGC141848|RAC3|SRC3|TNRC14|TNRC16|TRAM-1|bHLHe42|pCIP
Gene Description nuclear receptor coactivator 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCOA3 (NP_006525, 251 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8202

Enviar un mensaje


NCOA3 polyclonal antibody (A01)

NCOA3 polyclonal antibody (A01)