SYMPK purified MaxPab rabbit polyclonal antibody (D01P)
  • SYMPK purified MaxPab rabbit polyclonal antibody (D01P)

SYMPK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008189-D01P
SYMPK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SYMPK protein.
Información adicional
Size 100 ug
Gene Name SYMPK
Gene Alias FLJ27092|SPK|SYM
Gene Description symplekin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SYMPK (AAH30214.1, 1 a.a. ~ 533 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8189

Enviar un mensaje


SYMPK purified MaxPab rabbit polyclonal antibody (D01P)

SYMPK purified MaxPab rabbit polyclonal antibody (D01P)