SLC14A2 polyclonal antibody (A01)
  • SLC14A2 polyclonal antibody (A01)

SLC14A2 polyclonal antibody (A01)

Ref: AB-H00008170-A01
SLC14A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC14A2.
Información adicional
Size 50 uL
Gene Name SLC14A2
Gene Alias FLJ16167|HUT2|MGC119566|MGC119567|UT-A2|UT2|UTA|UTR|hUT-A6
Gene Description solute carrier family 14 (urea transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC14A2 (NP_009094, 40 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8170

Enviar un mensaje


SLC14A2 polyclonal antibody (A01)

SLC14A2 polyclonal antibody (A01)