AKAP1 polyclonal antibody (A01)
  • AKAP1 polyclonal antibody (A01)

AKAP1 polyclonal antibody (A01)

Ref: AB-H00008165-A01
AKAP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AKAP1.
Información adicional
Size 50 uL
Gene Name AKAP1
Gene Alias AKAP|AKAP121|AKAP149|AKAP84|D-AKAP1|MGC1807|PRKA1|SAKAP84
Gene Description A kinase (PRKA) anchor protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP1 (NP_003479, 806 a.a. ~ 903 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8165

Enviar un mensaje


AKAP1 polyclonal antibody (A01)

AKAP1 polyclonal antibody (A01)