COIL purified MaxPab rabbit polyclonal antibody (D01P)
  • COIL purified MaxPab rabbit polyclonal antibody (D01P)

COIL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008161-D01P
COIL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COIL protein.
Información adicional
Size 100 ug
Gene Name COIL
Gene Alias CLN80|p80-coilin
Gene Description coilin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COIL (NP_004636.1, 1 a.a. ~ 576 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8161

Enviar un mensaje


COIL purified MaxPab rabbit polyclonal antibody (D01P)

COIL purified MaxPab rabbit polyclonal antibody (D01P)