TAF15 MaxPab rabbit polyclonal antibody (D01)
  • TAF15 MaxPab rabbit polyclonal antibody (D01)

TAF15 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008148-D01
TAF15 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAF15 protein.
Información adicional
Size 100 uL
Gene Name TAF15
Gene Alias Npl3|RBP56|TAF2N|TAFII68|hTAFII68
Gene Description TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF15 (NP_631961.1, 1 a.a. ~ 592 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8148

Enviar un mensaje


TAF15 MaxPab rabbit polyclonal antibody (D01)

TAF15 MaxPab rabbit polyclonal antibody (D01)